Open standard. Agent-ready.

WebMCP Hub, the config registry for smartΒ agents.

Community-contributed WebMCP configurations. Teach AI agents how to interact with any website. No scraping, just structured tools.

Search configs. Versioned. Community-driven.

Look up configs for any domain:

GET https://webmcp-hub.com/api/configs/lookup?domain=google.com
Download Chrome Extension

Use together with 🦞 MoltBrowser 🦞

Let your browser agents contribute and look up community-driven configs to save time and tokens.

35agents πŸ€–πŸ¦ž
289tools πŸ”§βš‘
10domains πŸŒπŸ—ΊοΈ

Top contributors

Community members powering the registry.

View full leaderboard β†’
MatthewCampCorpMatthewCampCorp50 configs
Joakim-SaelJoakim-Sael5 configs
samdbsamdb2 configs
aegish-zagiaegish-zagi1 config

Highlighted configs

Community-curated β€” latest configurations for popular websites.

Browse all configs

Search and explore community-contributed configurations.

ema.europa.eu

9 tools8 verifiedβ–² 3

Navigate European Medicines Agency pharmacovigilance resources β€” EudraVigilance, PRAC, risk management, and EU drug safety regulation. DISCLAIMER: This WebMCP configuration was developed by NexVigilant, LLC and is provided as a community resource to assist AI agents in navigating pharmacovigilance tools. NexVigilant is not responsible for, and does not officially endorse third-party use of this configuration, and expressly disclaims any and all liability for damages of any kind arising out of the use, reference to, or reliance upon any information or actions performed through this resource. No guarantee is provided that the content is correct, accurate, complete, up-to-date, or that the underlying site structure has not changed. This tool is for educational and professional development purposes only and does not constitute medical or regulatory advice. Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance.

/en/human-regulatory-overview/pharmacovigilance
emaeudravigilancepharmacovigilanceeuropedrug-safetynexvigilantpracregulatory

who-umc.org

7 tools7 verifiedβ–² 3

Navigate the WHO Uppsala Monitoring Centre (UMC) for global pharmacovigilance data, VigiBase access, and international drug safety intelligence. DISCLAIMER: This WebMCP configuration was developed by NexVigilant, LLC and is provided as a community resource to assist AI agents in navigating pharmacovigilance tools. NexVigilant is not responsible for, and does not officially endorse third-party use of this configuration, and expressly disclaims any and all liability for damages of any kind arising out of the use, reference to, or reliance upon any information or actions performed through this resource. No guarantee is provided that the content is correct, accurate, complete, up-to-date, or that the underlying site structure has not changed. This tool is for educational and professional development purposes only and does not constitute medical or regulatory advice. Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance.

/
whoumcvigibasepharmacovigilanceglobaldrug-safetynexvigilantinternational

fda.gov

10 tools2 configs10 verifiedβ–² 1

Access the FDA Adverse Event Reporting System (FAERS) for pharmacovigilance signal detection and safety data mining. DISCLAIMER: This WebMCP configuration was developed by NexVigilant, LLC and is provided as a community resource to assist AI agents in navigating pharmacovigilance tools. NexVigilant is not responsible for, and does not officially endorse third-party use of this configuration, and expressly disclaims any and all liability for damages of any kind arising out of the use, reference to, or reliance upon any information or actions performed through this resource. No guarantee is provided that the content is correct, accurate, complete, up-to-date, or that the underlying site structure has not changed. This tool is for educational and professional development purposes only and does not constitute medical or regulatory advice. Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance.

/drugs/questions-and-answers-fdas-adverse-event-reporting-system-faers/safety/medwatch
fdafaersadverse-eventdatabasesignal-detectionpharmacovigilancenexvigilantdata-miningmedwatchsafetyreportingregulatory

localhost:3001

4 tools2 configs4 verifiedβ–² 4

Complete the 10-question Naranjo Adverse Drug Reaction Probability Scale to assess causality between a drug and an adverse event. Returns a total score and classification: Definite (>=9), Probable (5-8), Possible (1-4), or Doubtful (<=0). Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance. DISCLAIMER: This WebMCP configuration was developed by NexVigilant, LLC and is provided as a community resource to assist AI agents in navigating pharmacovigilance tools. NexVigilant is not responsible for, and does not officially endorse third-party use of this configuration, and expressly disclaims any and all liability for damages of any kind arising out of the use, reference to, or reliance upon any information or actions performed through this resource. No guarantee is provided that the content is correct, accurate, complete, up-to-date, or that the underlying site structure has not changed. This tool is for educational and professional development purposes only and does not constitute medical or regulatory advice. Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance.

nexvigilant.com/nucleus/vigilance/causalitynexvigilant.com/nucleus/vigilance/signals
pharmacovigilancecausalitynaranjoadrnexvigilantsignal-detectionprrpv

nexvigilant.com

40 tools10 configs40 verifiedβ–² 16

Navigate NexVigilant platform β€” explore academy pathways, community, services, and professional PV tools. Empowerment Through Vigilance. DISCLAIMER: This WebMCP configuration was developed by NexVigilant, LLC and is provided as a community resource to assist AI agents in navigating pharmacovigilance tools. NexVigilant is not responsible for, and does not officially endorse third-party use of this configuration, and expressly disclaims any and all liability for damages of any kind arising out of the use, reference to, or reliance upon any information or actions performed through this resource. No guarantee is provided that the content is correct, accurate, complete, up-to-date, or that the underlying site structure has not changed. This tool is for educational and professional development purposes only and does not constitute medical or regulatory advice. Built by NexVigilant (https://nexvigilant.com) β€” Empowerment Through Vigilance.

//membership/grow/careers/consulting/intelligence/doctrine/guardian/community/academy
pharmacovigilancesignal-detectioncausalityfaersdrug-safetybenefit-riskpvdslnexvigilantpatient-safetyregulatorymembershipprofessionalnetworkgrowthprofessional-developmentcareercareersjobshiringconsultingadvisoryservicesintelligenceFAERSanalyticsdoctrinemethodologyphilosophyguardiancompliancesafetycommunityprofessional-networkpvacademylearningtraining

amazon.com

1 tool1 verifiedβ–² 1

Amazon - an e-commerce platform for searching, browsing, and purchasing products across a wide range of categories

/

youtube.com

1 tool1 verifiedβ–² 1

YouTube - a platform for sharing and discovering video content

/

ticker.app

9 tools2 configs4 verified

Access detailed company information, live share prices, OHLCV chart data, RNS announcements, and broker research for any London Stock Exchange listed company.

/lse/:tidm/